PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT31777
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 303aa    MW: 32427.7 Da    PI: 6.7562
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT31777genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.13.2e-32160218159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK vk+s fprsYYrCt a+C vkk vers++dp++v++tYeg+H h+
  EMT31777 160 LDDGYRWRKYGQKAVKNSSFPRSYYRCTAARCGVKKLVERSQQDPSTVVTTYEGRHGHP 218
               59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-32147220IPR003657WRKY domain
SuperFamilySSF1182904.84E-28153220IPR003657WRKY domain
PROSITE profilePS5081130.458155220IPR003657WRKY domain
SMARTSM007747.0E-36160219IPR003657WRKY domain
PfamPF031062.7E-25161218IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MSGSAAAGGG DLGGGQFYGD HPPADDVFFQ SRSACGGEDD GGVTPSAYSS ITDYLQGLLD  60
PAELARHLDA PPCPPTMRAV IGEAAAPVTP NSSTSGEAAG VESHGCKRGS PVPEEGDEDG  120
SADHHNHRSD EKEQKKKGKW EKKARGSRVA FATKSEVDHL DDGYRWRKYG QKAVKNSSFP  180
RSYYRCTAAR CGVKKLVERS QQDPSTVVTT YEGRHGHPSP VAAHHGARML MATGADTSYS  240
LAALQHHQHD FLPAGADVYG RMCMQPTTAV TPSVAHRLSE YGGMQFHADL LPDDAMGYQH  300
GYR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-261532201077Probable WRKY transcription factor 4
1wj2_A3e-261532201077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8273970.0KR827397.1 Triticum aestivum WRKY46 transcriptional factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147623.12e-57WRKY11 - superfamily of TFs having WRKY and zinc finger domains
TrEMBLM8CVX00.0M8CVX0_AEGTA; Putative WRKY transcription factor 23
STRINGMLOC_44947.11e-109(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.13e-40WRKY DNA-binding protein 71